dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_004863059.1.39548 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: rac GTPase-activating protein 1 [Heterocephalus glaber]; AA=GCF_000247695.1; RF=representative genome; TAX=10181; STAX=10181; NAME=Heterocephalus glaber; AL=Scaffold; RT=Major
Sequence length 632
Sequence
MDTMMLNLRSLFEQLVRRVEILSEGNELQFIQLAKDFEDFRKKWQRTDRELGKFKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSGNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSFVKNLKLKKR
QKRRSSSQQFVDGPPGPVKKTRSIGSTVDQGNESIVAKTTVTVPSDGGPIEAVSTIETVP
YWTRSRRKTGTLQPWNSDSTLSSRPLEPRTETGTSSTPQSNGGMRLHDFVSKTVIKPESC
VPCGKRIKFGKLSLKCRDCRVVSHPECRERCPLPCIPTLTGTPVKIGEGMLADFVSQTSP
MIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS
LLKDFLRNLKEPLLTFRLNKTFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
QRVAQSPSTKMDIPNLAKVFGPTIVAHAVPNPDPMTMLQDIKRQPKVVERLLLLPLEYWS
QFMIVEQENIEPLQVIENSNGFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRS
TLARNTPRFGSKTKSATNLGRQGNFFASPMLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]