dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005629334.1.84170 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: GAS2-like protein 3 isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence length 661
Sequence
MTMQPAIQVWFGEDLPLSPRSPLTPRHGPGLADVCQYDEWIAVRHEATLLPMQEDLSIWL
SGLLGTEVKAERLLEELDNGVLLCQLIDVLQNMVKACNSEELENFPMRKVPCKKDAASGS
FFARDNTANFLHWCRHIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVL
VKLEKEIELEETLLNTSGPEDSISIPKSCCQHEELHEAVKHIAEDPPCSCSHRFSIEYLS
EGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQKG
VSNESVPDSSARTPQPPDMNPLSAVSLFQKQKSKPGPPVGVARSKEKQVRPPGGLLPAAP
LNGGDLGSSHLKLKSSKGAAKKPQAPSGSAAGASTSAAAAPEGSAREPRPLRRGAPPSAP
EARLLPAPRPARPPAAALLPSQPAGKTEPKPLKPAAVRARVGPESPAAAPSASCERPEPR
RANTHLRPRPSPALRPPAKMTKSGPKSTAPRPGPRCPPPAGAARAAPSPSAAAAAAKAAQ
DSEGKAVVPGAKKQPPGQSTSPKRGPGRPRPPGRAPLSLVSLPQASAQSPTARGAARGAA
RGAAGGQPPAPRPPGRGGGPAATRAPPAPRKEAASAGKKPTAKKEVDDHYFVMTGSKKPR
K

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]