dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005758221.1.92643 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein EMIHUDRAFT_438902 [Emiliania huxleyi CCMP1516]; AA=GCF_000372725.1; RF=representative genome; TAX=280463; STAX=2903; NAME=Emiliania huxleyi CCMP1516; strain=CCMP1516; AL=Scaffold; RT=Major
Sequence length 362
Sequence
MTDTSWTTKTAAAQDTRPVSSAVHTGYDAAEKTEDGIPLYGMDKELAAKAAAKRDPKKEQ
EARGWIEALTGMSLDGTLQEALKSGIVLCALATAIKPGVCKKASTMAMPFKQMENISNFL
DACTKLGVGKHDLFQTVNLYENKDMNSVLLTLEALGRVASKMPDYKQEWPTFGAKLADKS
VRHFDNETLAKGKAAQTFIGRGSTGQANQSGMVDTSRNIGKMDQVKGIDGLGGDGTATMV
GMGSHGHASQAGTYDTSKNIDKTAHVKGTEGLGGDGTATMVGMGSHGHASQAGTFDTSKD
IDKMKNVKGDGVDELGKEGISAINLGSTGLASQSGMYDTSKDIDKMKNVVQETHGGGVPP
AA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]