dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_005844553.1.22496 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein CHLNCDRAFT_138760 [Chlorella variabilis]; AA=GCF_000147415.1; RF=representative genome; TAX=554065; STAX=554065; NAME=Chlorella variabilis; strain=NC64A; AL=Scaffold; RT=Major
Sequence length 898
Sequence
MLQPIAAAGAAALQGTATGPRAALFFSLTLLGIKSKQDFNAGMKVSYKNTLMRMAPGSTI
IPVAIEPDDTGQSIHTVALFPGSVAAGTVAAQQLAAKLRAGGLNAYFDQRKFRRVHAEVV
ADPYLADSTGDTIPSLPGSRPVAMITVKWYDLAPDQVTAQKRKAYVAAIQKLVPAALQKL
AMDTLMSNAAPTALAKALNTMRTRPASFGQMASDDGYAVRWVPDSSFVSPCDVHTTLTLA
GINVYAPSCTRQLVTAYLAALKTKLPSDVVTSVVSAMHVSSGCRVVTSSAYPGSQQGAAM
DLAGRKVPSNYPLNGTVFGAGSKTPAFFAEGAAATGQQRGMVTARHLLLDAAAYEYKLQP
VNCAPGKSCPTLTFTFATADAYFSGLSPGTTYNVTVEGISNTGQRTAGQNTLQFTTPASV
HLESAQATSSTTATATATTQPAGAFPQYMYSLRKLGCITCKSLNFPSSTATVNLHGLEPG
ATYNVTVEGISKTGQRTPGDNMLQLTMPAGLRLTQAKATGYTTGAATARALPSDAFTKFV
FTVTKARCTVPPCPTLAFTSRAPSNQLTGLEPGTKYNVTVLGVTKTGQRTKGANMMQLTT
YMFTVKKALCPGCPKLEFNSSTRMGTFTGLAPNTAYAVTVAGVDWSGRRTQGSNSLQFKT
PTKSAPPPPPTPTLKLTSARATTPTTAIATASPQPPGAFVKYNVTVAGMDKSGRKTQGIN
MLQFKTLDAHPHRLVWPSLVQFIFTVKKAACPSCPALHFTSNTTLGVFSGLTPNTTYQVT
VVGMDKTGRRTPGSNALHFKTPAGAFLRAPPSPPPVAPKSLMLISAHATSPTSGTATAQP
QPAGAFVKYIFTLQEVACPSCEPLAFSSTTSVGIFTGLKPNTKVSMCRVTAVDSGRQT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]