dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006405006.1.70970 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein EUTSA_v10000111mg [Eutrema salsugineum]; AA=GCF_000478725.1; RF=representative genome; TAX=72664; STAX=72664; NAME=Eutrema salsugineum; AL=Scaffold; RT=Major
Sequence length 549
Sequence
MANKHFFKPLLPGFHSHLTIPVAFFLKYIKGTNEQKKTTAKLRSDASDITWEVKIEDGQK
LTDGWKEFVLAHDLRVGDIAIFRQEKDMAFHVTLMGPSCCEIQYESGLDDENNLGKIPKK
TKVKKNPRKETESSSLDPSCFVAHVTHASLRYDSLNLPMSFARANGLNTRCGEIVLMNDK
GRSWTLALKQKKCGSTYIRRGWRTFCSANGFKAGEAFTFKLIQRGKVPVLRLSTTESEEE
EESSGADEVESLSTEPESDEESNLAEIQRRKKLKKNPERETESYPLDPSYFVAKVSPSTL
RQDRLYLPRNFSRENGLDTRCGEIVLMNEMGRSWTLNLKRKNSCGTAYIRRGWRSFCRAN
GLRAGDSITFKLIQRGGTLVLRLSPTDSEEEEEEEEEEEEEESSEGDEIESLSTEQESDE
EGNQDEKSFKKPRLLWKASSTPSQNRFVTLTLKPFNLTKYVMLLPIPFTRMHGINEETKM
SLVDKHGVRWSTNLRSEITGDRIRMVGGWQEFFKANCVKIGESVMLKLIWEGDKSCVLKF
CSKLKQVTK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]