dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006659013.1.55871 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: B3 domain-containing protein IDEF1-like [Oryza brachyantha]; AA=GCF_000231095.1; RF=representative genome; TAX=4533; STAX=4533; NAME=Oryza brachyantha; AL=Chromosome; RT=Major
Sequence length 364
Sequence
MGQMDGGGDGGGYPYHYQALLAAVHQQTVPFPNPFPAPSSGTEAPLHNHSHNHNHNHNHN
HNHNHNHNHNHNHNHNHNAAPHPHTPTPRGFADWSASTSAFTSLAAHSSPAPSNAVHYSF
SPCYAFWAHYMVNKNAYPSFPAPHEEPPHQLRLANSHPRDASGPASSFGVESFNSASMAP
NICNHMPPIEGPISANEDKKPEILPRVIKSSDELETRNSGVELHCETVGALPESKQSHES
RATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPMILHMDDMVLP
VTWKFKYRYWPNNKSRMYILDSAGEFLKTHGLQAGDVIIIYKNLASGKFMIRGEKAIHQQ
TTNS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]