dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_006832211.1.41390 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP9 isoform X4 [Chrysochloris asiatica]; AA=GCF_000296735.1; RF=representative genome; TAX=185453; STAX=185453; NAME=Chrysochloris asiatica; AL=Scaffold; RT=Major
Sequence length 457
Sequence
MGFRARGWRPPLPPLLLLLLWVTGQAAPVAGLGLGPDTELQIERRFVPDECPRTVRSGDF
VRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIGLLGMCVGEKRIITIPPFLAYGEHG
DGKDIPGQASLVFDVALLDLHNPKDGISIENKIVPENCERRSQSGDFLRYHYNGTLLDGT
FFDSSYARNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSA
VLVFDIHVIDFHNPSDSISITSHYKPSDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLG
KTYNIVLGSGQVVLGMDMALREMCVGEKRTVVIPPHLGYGEAGVDGEVPGSAVLVFDIEL
LELVAGLPEGYMFIWNDEVSPNLFEEIDKDGNGEVFLEEFSEYIHAQVASGKGKLAPGFD
ADMIVKNMFTNQDRNGDGKVTAEEFKLKDQETKHDEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]