dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_007040282.1.67643 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: BTB/POZ domain-containing protein At5g41330 [Theobroma cacao]; AA=GCF_000208745.1; RF=representative genome; TAX=3641; STAX=3641; NAME=Theobroma cacao; cultivar=B97-61/B2; AL=Chromosome; RT=Major
Sequence length 469
Sequence
MSSFGMQCLETEPELNSNVVTINVGGQIFQTTKQTLTQGGPKSLLSQLAETTSKRFVDRD
PDYFSLLLSLLRSGTLPSKVKDFDLHDLIEESRFYGLESLLNNSLTNPSHFDAFALQKSL
ILPLNGRDSPSTIATTPSGTVHVAHGSKITSFDWSLTRKSTILTQFTAVDSLLAISPDIA
AAGATDFSGLQILDLQNGSVKQVLNWENVTRSGSTVQAIGSSSEFLFTSFESGRRNSNSI
MVYDLNTLNPVTEIGHNEIFGADLDSAIPATKLRWVTGYGLVMASGSHSGLSGVSGNIKF
WDIRSGNVVFELKEKDDCFSDVCVSDNLNAIFKVGVNSGEVFYTDLRSLGSVSDDANDNS
NPWICLGNSRKVVNGKKEGYGCKIESHGNQVFCSKGGDIELWSEVVMGSAKISEGPLKER
RVFRKNLMGRVKDLGGLRITNLAFGGNRMFVIRKDQQAVEIWQGSTRGI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]