dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_007882018.1.23263 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PFL1_06286 [Anthracocystis flocculosa PF-1]; AA=GCF_000417875.1; RF=representative genome; TAX=1277687; STAX=84751; NAME=Anthracocystis flocculosa PF-1; strain=PF-1; AL=Scaffold; RT=Major
Sequence length 425
Sequence
MPSDRLSAAARLLVQAPPGQVSQVYHDLRGILLDPEAGADDGQTIDDAQIKHMALVALEE
YNTSQLIPVAIDEAAKDHVIICQAAQIPSSTDTATKRYAHPRAKKSFAFDHMARTASDIQ
DLPVDEDAEPLRAALDAALQNYVADRYNSGVSSVFAVSNVPYKPAAPTAAASSDAQQQQH
EEAAKVDAEDPAVPTAAAAANEDAETEGAEKKGDGSPNQEGDATAADDDGDNVKDDPVEA
AAASEAVSSDSTSPTAAAAEEARDASEQQQPQEQEPETTPRQIKYTFHHVGNKYHLSNFW
SGRWRASYTLDVEAATLTSSLQVQVHYFENGNVQLNASKPKTFHLDQSSLAGEGSESEHV
KRVAEHVVKLVERHEDDYQSLLEETYEDLGEKAFKALRRQLPLTKNKIDWNQLMNYRLGA
ELARQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]