dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_008656006.1.34533 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment AP2/ERF and B3 domain-containing protein Os05g0549800 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence length 375
Sequence
MDSTSCLLDDASSGASTGKNKPAPVPAPAAVTGKPLQRVGSSGASAVMDAAEPGAEADSD
GARRAPGGVGGKLPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTGEAEAARAYDVAAQ
RFRGRDAVTNFRPLAESDLDPDAAAELRFLASRSKAEVVDMLRKHTYGEELAQNRRAFAA
AAASLASPQLPPAKNTSPAAAREHLFDKTVTPSDVGKLNRLVIPKQHAERHFPLRRVQGG
RAPILSFEDAAGKAWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSAAAGRQ
LFIDCKLRPKAVRLFGVDLLTEPPRSAAAVAQPEPEQEEIAVSKNKRARDAIAASATPVH
IAFKKQRVDVALTTT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]