dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_010614160.1.5607 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: F-actin-capping protein subunit alpha-3 [Fukomys damarensis]; AA=GCF_000743615.1; RF=representative genome; TAX=885580; STAX=885580; NAME=Fukomys damarensis; AL=Scaffold; RT=Major
Sequence length 299
Sequence
MAVSVLSRKEKERVIRRLLMQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYC
VPLCIDGNPVLLSHHNVMGDYRFFDQQSKLSFKFDLLQNQLKDIKSHGIIRNETEYLRTV
VLCALKLYVNDHYPAGNCNVLRKSIKNKEFLIACIEDHNYETGECWNGLWKSKWIFHVNP
FLTLVTGRIFVQAHFFRCVNLHIEISKDVKESLEVVNQAQLALSFARLVEEQENKFQAAV
CEELQELSNEVLKKNLRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]