dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_013281528.1.45204 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Z517_07553 [Fonsecaea pedrosoi CBS 271.37]; AA=GCF_000835455.1; RF=representative genome; TAX=1442368; STAX=40355; NAME=Fonsecaea pedrosoi CBS 271.37; strain=CBS 271.37; AL=Scaffold; RT=Major
Sequence length 921
Sequence
MAQATSRKNAASQKAASPAPASRQANSDMIRSQSSKKKSYASEGVTDNDIFLLPAGDYQI
MALLTLLAGVVRLFKIYQPTSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLLITLAGWL
AGFNGDFDFKDIGKDYLEPKVPYVSMRLLPAILGVLTIPTMFLTLKAYGCRTVTACLGAG
LLIFENGLITQSRLILLDSPLVICTAFTALAWTCFTNQHELGPAHAFDVTWWFWLAATGL
GLGATVSVKWVGLFTIAWVGTLTILQLWVLLGDSVNVTPRKWFKHLFARVFCLIVIPIAF
YVGMFGIHFLCLVNPGDGDGFMSSEFQATLNNKGMADTPADVLFGSEVTIRHHNTQGGYL
HSHSHMYPGGSKQQQVTLYPHKDENNIFLLENQTQPITADNVTVAGPKAWSNLTEFIRNG
DVIRLYHLTTHRRIHSHDVRPPVTEADWQNEVTAYGYEGFEGDANDLFRVEIVQSMSDGE
EAKKRLRTIQTKFKLVHIMTGCVLFSHKVKLPDWGFEQQEVTCAKGGTLPNSVWYIEQNQ
HPMLGEGAEKVNYRNPGFLGKFWELQKVMWRTNAGLTESHAWDSRPGSWPILRRGINFWG
KDHRQVYLLGNPAIWWPSTLAILTYVIFKGIAVLRWQRSCNDYSNVNFKRFDYEIGQTVL
AWAFHYFPFYLMARQLFLHHYFPALYFAIMAMCQIFDFVVNRISSLGLKKYPEIGWSVAV
LFVAFAIGVFTLYAPLIYGNPWTQDQCRAVKLFDTWDFDCNTFYTDYAQYSTPLPSFGDG
GATPTVPSMQIDSGRKDNPSAVTPQVGEGKVIGQEERVEYRDQDGNLLDEAQVQALLAEG
KASFQTKYETRTRLVDEEGNEVNSSGVAPDHPDVEGQNPSTKGVPEEQANKSPADAQAGG
SVKKGDDSKAKPASDASEATK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]