dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_015179928.1.70865 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: rootletin isoform X2 [Polistes dominula]; AA=GCF_001465965.1; RF=representative genome; TAX=743375; STAX=743375; NAME=Polistes dominula; AL=Scaffold; RT=Major
Sequence length 1929
Sequence
MDPTYSTVSCPEDDEETLSPEALVRQNYELRHRLEEEAACYKRRLDTYRQAQQHQAALVS
RLQAKVLQYKQRCSELENVMAETAAIDNSKLPIQPQSTSALDVAHQTLREMREEQIHDLD
TALNKLAEERKKCEKLLELNTSLKDQLEETSQTNEALTNDLQKLSNDWDVLREELTIKEE
EWKEEEQAFNDYYTSEHNRLLNLWRDVVSVKRLFADIKSSTDRDLSKLSNQITSTTNDIV
STCNNTSIFMKMQANLIQPSVAQQIHESQIVMEMKSEMGSLKQQYDVAQNEIRMKDDRIN
QLIREIHALEERCGEAEAQTNNITRMQEDIEVLQNALRDIAHTVIQDAETRDSENTQPPP
HVHLSPTGPIPQRSPRRGGRANTIPAFAESTISAVQAALHKYQLTIHDLQVKLQTHKEQL
SSFRKQSENAEENVRTLQVKVTELVEELDSTRSQCTQLVQEKEVLQKNLDTIKMEKNVLE
KNRMEINAMVETLNADYDKIQKANNKLQKMCDSLEDDKLYLQGELERLSKDAELRELSLR
SEENRCSKMREELLTLQEELNKTYLKKDMLEQQKLETDALISQIEKSKGDLELELEHLLL
EKSDLKEVLLKLESVCSNHEQDKQRLQEELKKTTEEKNKLANQCTDQQGDLGSLRKELLQ
AEQTRLDLESDKVTLNEKVKFLEIEKEKIEMELSQVTRERSDLSNQLSVLARKKETLNEE
LMRVRQRLEQANEMNSRINRSLEDLVKDNEEKQVLLETNEKELQRLQEQIASIRSEKETL
EGVLYDTQTNLESTHIKKSQLEKEQKELLIKQETLKGHIGRLSKDLENSQKQSQDIKQAL
AQQCCDQEANFQQALFNLKKQNEENVKKLNEEKEQLKVTLEKRLQQSLSQLGGEKNDEIN
QLQQRVQELQQHIENLCQQHEEVLLRAENDKQQALLIAHHDQQALMEKLENALRELEEEK
GNLERLKRDTTIRSEQDRNNLNQLRDNLNRFKTKLDETKLKGDEDKLKLELKIEELLKER
ESVQKESEELRVQLHMAEDKLDGLHNQLHETVRKLKDYENVNDTLRKELVDVRRQLTDST
FEKEKYNTSNKELREHIKRIEGEKREQGRALEETYQKIAALEDAKTGMETERSRLQAQFR
DMERDLIQVQQQLRLTQDELQKSTENNAQAQNNEKELQARLANETEERERLQLQLHQVKK
QVLDLDNSLEVTRQELGKLRSRSDEEDERWRSREQELLLRLEDSRCRERKLEDQKHNLEV
CLADASQQIQELKARLGGSEGRVRALDAQLSQLEVAKKEVEQKLSSIGLTLRRIAGIQMD
GSVNMPFKLMSPSRRWSPARGHEHGDSSKDIVIDVDPEAVRRGMRSLMQQVAQIERERDD
YKTELSSVKTQLTEYQENQNKVDERLNNLLSSIRTMQEEKNSLEARISQRETSHQSQMDI
LQQKTDECDQLREKVISLEMIVNSDTEEKNLYEEKLEKMKQTLNRMENERRNLQEELSKS
EARATKLELQRMSLDGDLQRLQMMLQEREANVQKLQDRCESQNRTTAGLEERCASLKSTI
EQLNLALEKSFNTESELKNEINLLQRNLMESTTCSQSNNEKLKQLQKQLSNTENERRVMA
ERLDSVQQSLSDLRHMNQNLQDQVARLQTELANNEVQRSGLEAQLRLTKWPQEGSADKDE
DLMRQLQIIQREKSEMRGKLDTLNDKVKLLETEKRSLETQVSTLKSVGTRSKSYERPEKA
HIELLGSSYSFDNLEQENRELRLKIRRLETQLAEKEAELIRTKSVYTHSHSALESSRDRT
GEIERLRAAQLQAEKLLEAREQSHRQQIIRLENQIQLLREQLNQEIKRRQLYVLRSSRAG
REMQQLRQALGDSLRTVAQDPSLDAVLLEHEARKLDNTLTSTTSLPPSLALAPSSAYDRS
STPSRLEKT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]