dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_018658902.1.75393 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment F-actin-capping protein subunit beta [Trichoderma gamsii]; AA=GCF_001481775.1; RF=representative genome; TAX=398673; STAX=398673; NAME=Trichoderma gamsii; strain=T6085; AL=Scaffold; RT=Major
Sequence length 283
Sequence
MAADPFDSALDLLRRLNPKHTSEHLNAIISLAPDLTEDLLSSVDQPLTVKRCRQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEGGVGGVGPGSNDGAGEGAIPNERVRKMEIKANEAF
DVYRELYYEGGVSSVYLWNLDDGFAGVVLVKKSATPGSNTEGVWDSIHVFEAIERGRTTH
YKLTSTVILSLSTNVESTVGDMDLSGNMTRQVEQDLPVENDDSHIANVGRLVEDMELKMR
NLLQDVYFGKAKDVVGDLRSVGSLSDGAKERETQRELIGSMKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]