dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_020192155.1.58150 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment B3 domain-containing protein Os06g0194400-like [Aegilops tauschii subsp. tauschii]; AA=GCF_001957025.1; RF=representative genome; TAX=169297; STAX=37682; NAME=Aegilops tauschii subsp. tauschii; cultivar=AL8/78; AL=Contig; RT=Major
Sequence length 217
Sequence
MAEPNSCEEQCRRQVEENKRKLEELRLHRLSVAVREAAVKPKPTKLPRRCRDAPTRLSGR
VAGLPEQPDYRDRKIRGGAYVDRRQLPPDDVYATDEASAYALTKAEELKSQLCFDHPSFV
KPICYKTATASCLRIPQLFKEWYLPWCNEMIYLVDEQDVEFHLPYYALSGSIGTGWKMFA
ISHNLADGDCLVFQQVQKTKFKVYIIRASSYYEKDHC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]