dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YP_001326766.1.44884 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GDSL family lipase [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence length 213
Sequence
MKTVLCYGDSLTWGFDAVGSGRHALEDRWPSVLQKGLGSGTHVIAEGLNGRTTAYDDHLA
DCDRNGARVLPTVLHTHAPLDLIVIMLGSNDMKPIIHGTAFGAVKGIERLVNLVRRHDWP
TPGEDGPDILIVSPPPLCETANSAFAAMFAGGVEQSAMLAPLYRDLADELDCGFFDGGSV
ARTSPIDGVHLDAENTRAIGRGLEPVVRMMLGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]