dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

SNOT_07678 (Stagonospora nodorum )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | SNOG_07678 | Stagonospora nodorum predicted protein (459 aa)
Sequence length 458
Sequence
MRSLATSASRHIRPVVFRAQCPTNLIPLRAMSATTRREDPFKPAARVAGQKQDVWSIVNE
AAAASPVQPIVNMGQGFFGYNPPKFVLDAAKSALDQVDCNQYSPTKGRPRLKKAIADAYS
PFFGRTLDPDKEVTITTGANEGMLSAFMGFLEQGDEVIVFEPFFDQYISNIEMPGGKVVY
VPLHPPKDGATKTTSASEWSLDLKELEAAITPKTRMIVLNSPHNPIGKVFSKEELQAIGD
ICVKHNIIILSDEVYDRLYYVPFTRVATLSPEIAKLTLTVGSGGKNFYATGWRVGWLIGP
EHLIKYVSAAHTRICYSSVSPLQEATAIGFEQADAHGFWDESKREMKAKMDKFTAIFKEL
DLPYSDPEGGYFVLVNMSKVKLPEDYDFPPHVAERPRDFKLSWFLIKEVGVAAIPPTEFF
TPGNAHIVEDWLRFAVCKNDDVLETAMERLRGLKKYIQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]