dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Necha2|65315|estExt_Genewise1Plus.C_sca_8_chr1_1_00764 (Nectria haematococca mpVI )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 719
Sequence
MGGVISSFSGSSGEDSIAARQALEKKLADREETISVLEEDLSKKEKECTTVSQDVEELRK
KIKELEAQSSSALDETHARIAILQDELKKGGDTSSEQLRNTKEAASKSAQDLDAAKAELV
ALEDKLNTVEQEKQSIVDQLAALKAELAEVKEAREALESALNKEISTLKAQITEAEEKNQ
TLQQAHSKLEGDLTAASSAADEGKKALTGTEEKYTTLQQTHDKLETDLAAAVSALDEQKK
ALAGSEEKYTTLQQSLDKLKEESDAQLSSAKTDLAQAEEKTAALQQTHDKLKTDSESELS
SLKAQLAELSELQTKHAALEQTNQALEKELAELKEKVASLEKNNEALKSDSSAGLVAAQK
EAAEWQEKHSALQTTHDGLSSDLEAVKKQLADSEEAQKKSSEEQAALEKKLEEQEAKLND
VEKQAEEAKANATKVEEDLKASQAEKEALQAKIAGLESDSQTSKESESGLKTKLEEAEAK
VTSLEADAAKAKETESELKAQVEAAQAKVTSLEAEVQQAKDAEAALKTKVEEAEAKAASL
ESELQKAKDAEAELETKVEEAEAKIATLEADAQKSTDAESGLKTKLEEAQATEADLKSKL
EEAQAGQTSAQTEKEEALEKAAEAAEKVKALEAEKTSADEKATALEKEKTDAEEKTKAAQ
SAFTSALEKVKAIQAEKKEAVEKSEASAKETADALEKIKALEAELTELKAKQTNGTAEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]