dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|406706485|ref|YP_006756838.1| (alpha proteobacterium HIMB5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein HIMB5_00009090 [alpha proteobacterium HIMB5]
Sequence length 242
Sequence
MNFSLEIGPHTDLSTLPAVKDVYVTLLPGGDYKETAKKSGDLVKEGFNPVPHVPARSISN
DEELKDYMNMCKDLGVKQALVIGGSREPIGKFDSSFQILETGYLEGIKIGIAGHPEGSPD
ISDQDLEKAMIDKKPYADYIVTQWLLDTQPIIDFISKQSVPVHVGITGPMKISSLIKFAN
IVGAKNSINFLKSNFSKALDLLKPKDPNDLIGKVKSHTDNFHIYTFGGLKETNKWLKENK
YV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]