dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|85059421|ref|YP_455123.1| (Sodalis glossinidius str. 'morsitans')

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcriptional regulator SlyA [Sodalis glossinidius str. 'morsitans']
Sequence length 144
Sequence
MESPLGSDLARLVRVWRALIDHRLKPLELTQTHWITLHNICQLPPEQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLITRHTCANDRRAKRIKLTESAEPIIKEVNNVIDSTRNEILNGISQ
EEIQLLSNMIAKLEKNILELYNKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]