dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSOPRP00000000253 (Ochotona princeps 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3815:26083:28796:-1 gene:ENSOPRG00000000281 transcript:ENSOPRT00000000281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 382
Sequence
MDEPATNNLLTKLGSAFIRKEPYGLVLIIAPWNYPLNLTLMPLVGAIAAGNCVVLKPSEM
SKGSEKVLAEVLPQYLDQSCFAVVLGGPEETGRLLEHKFDYILFTGSPRVGKIVMTAAAK
HLTPVTLELGGKNPCYVDDNCDPQTVANRVTWFRYFNTGQTCVAPDYVLCTPETRERLLP
ALQSAITRFYGEDPRSSPDLGRIINQKHFQRLQALLRCGRVAIGGQSDESQRYIAPTVLV
DVQEVEPVMQEEIFGPILXTVGGLDEAIAFINCREKPLALYAFSNNNQVVKQLLERTSSG
SFGGNEGFIYLTLSSLPLGGVGHSGMGKYHGKFSFETFSHHRACMLAPPGLEKLNEPRYP
PYSERTQQLISWALSFPTCTLL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]