dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSOPRP00000002034 (Ochotona princeps 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection scaffold:pika:scaffold_1989:43744:57092:-1 gene:ENSOPRG00000002197 transcript:ENSOPRT00000002203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 496
Sequence
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEQRLREEARPRGEL
RLREEARLREEAPLRARPTAAPPRAEPWLSPPASAHPKPGAYGDLGASAASWAGSRGLAY
PARPAPLRRRASVRGSSEEDEDARTPDKAALGQGLSGRRWWAASPSPARPSSSLLSPDPR
PGLRAARAGLAGAARARPEVGRWLERCLSRLQLTSGLLLVFVCILVMAKPSAPQEADNMK
LLPVDCEKKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPEKLKSKCIPVVDAQE
YLANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDPSELVTTVDKVVCLESARPRMGVGC
RLSRALLTAVTNVLIFFWCLAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIIDVVQDHYV
DWEQDMERYPYVGILHVRDTLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDM
LVWRWTKPSSFSDSER

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]