dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSOPRP00000003874 (Ochotona princeps 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3296:97943:131834:1 gene:ENSOPRG00000004203 transcript:ENSOPRT00000004204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 609
Sequence
LGDAWGQPSRAGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVEL
TGNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSG
YKVIHCSGYLKIRQYMLDMTLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLD
LKLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDAFHLRYAHHLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQYSPFQMDKLECSPLGSWRVSPPAGTAAAP
DQQLHSESNELLYAPSYSLPFSYRYGPFPLDSHVFSGKQPMLPAKFGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAAVTARRFAEDT
APPSFPSCGHYREEPGLGPAKVARQAAVARDGARGCVPECCAPMAPEPPGAPAQLPLVLL
NYHRVLARRGPLGNAADPVPGPAGGPDTEAGAAGTASGLRPRLPSPAGPPPGAPRPHYLG
ASVIITNGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]