dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSOPRP00000012413 (Ochotona princeps 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1127:804252:982645:-1 gene:ENSOPRG00000013577 transcript:ENSOPRT00000013604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1281
Sequence
MELEDGVVYQEEPGGSGAVMSERVFRLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRNHAEESRLEEREAELKKEYNALHQ
RHTEMIHNYMEHLERTKLHQLAGSDQLESAAHSRIRKERPISLGLFPLPAGDGLLTPDAQ
KGRETPGSEQWKFQELSQPRSHTSLKVSNSPEPLRAVEQLDELSDVSQSGSKATTPASTA
NSDVATIPTDTPLKEDNEAFVKVTDTANKSEISKHIEVQVAQETRNVSTGSVENEEKSEV
QAIIESTPELDMDKELSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGA
DLLGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLK
LEEKNKELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKER
LMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAP
TSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDG
RVQAFGWSLPQKYKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSASQSSLDKLDQELKEQQKELKNQEELSSQVWI
CTSTHSATKVIIIDAIQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEELSESGQVDK
ASLCGSMTSNSSAETDSLLGGIAVVGCSTESATGAAASPSPSRASPVVEKAPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNG
SDGCKDQISVLQNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLK
DSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKV
WCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTY
QHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSG
APGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQ
SGSSGTDLTGDKAGPPAQEPGSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLE
PSVTRAERSHLIVWQVMYGSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]