dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSOPRP00000015661 (Ochotona princeps 76)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5171:193936:211087:1 gene:ENSOPRG00000017159 transcript:ENSOPRT00000017158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 504
Sequence
MECEVQRVRQAFRSGRSRPLRFRLQQLEALRKMVQEREKDILGAIAADLCKXXXXXXXVK
EVNAILGEIDSMLRNLEWITAQVKKTFTMLDEAYIQAEPLGVVLIIGAWNYPFVLTMQPL
IGAIAAGNAVIVKPSELSENTTKVLSKLLPYLDQDLYTVINGGVQETTELLKQRFDHILY
TGNAAVGKIVMEAAAKHLTPVTLELGGKSPCYVDRDCDLDTVCRRITWGKYMNSGQTCIA
PDYILCEAQLQDQIVQKIKETVKEFYGENIKESPDYERIINLRHFKRIQSLLESKIAFGG
ETDEATRYIAPTVLTDVDPKSKVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLIKRMINETSSGGVVGNDVIMHFTLNSLPFGGVGYSGMGAYHGKHTFDTFSHQRS
CLLKSLKGEGANKLRYPPNSQSKVDWAKFFLLKQFNKGKLGLLLLTVLGILAAVLIKKYQ
AVLRRKALLVFLVVHSLRGSGKQW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]