dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|58040545|ref|YP_192509.1| (Gluconobacter oxydans 621H)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Gluconobacter oxydans 621H]
Sequence length 1217
Sequence
MIIGLRPSVVSEAESMSTFVPSYPVRSSLRQAIAADMRRPEAECILPLIEQATLTETEQQ
NTFDVARHLTRTLRTQRRPGGVEALVQEFSLSSAEGVSLMCLAEALLRIPDAATRDALIR
DRIGTGDWLSHVGGKKSVFVNAASWGLMLTGKLTNDTDEGLAAALFRLVGRGGQPLVRRA
LDIAMRMMGEQFVIGETIEEARKVSTEPEERGFKYSYDMLGEAAMTEADALRYRRDYERA
IDVIGQTARGANVYEKAGISIKLSALHPRYAFAQRERVLKELGQTLKDLVIQARRYDIGI
NIDAEESERLDLSLDLIEDLCHCPELDGWNGIGIVVQAYGRRAPKVLDYLIDLGRRSGHR
LMIRLVKGAYWDSEIKKAQVEGQTDFPVYTRKCYTDVSYIACAKKLLAARDVVFPQFATH
NARTLATIYTLAGLNFQIGDYEFQCLHGMGETLYNEVVGPQKLNRPCRVYAPVGSHETLL
AYLVRRLLENGANSSFVNQIGDESLPIETLIADPVALAKAVQPPGASHPAIALPKDLFVP
ERTNSRGLDLTDEHTVTALAEAVCASEKQTLEDLSCSGETQEIRNPANHLDRIGSVRFGT
EEDVRKAIDAAESEGAAWAALSADARSTKLDRAADLLEEHQSELMALLVREAGKSYANAL
SEVREAVDFLRYYAVQARETAQAGSSAPLGVVACISPWNFPLAIFLGQISVALAAGNTVV
AKPAEETPFIALRAVALLREAGVPENALRLVPGAGETGAALVADPRISGVMFTGSTAVAG
LIASTLTSRTGADGQPVPFVAETGGQNAMIVDSSALTEQVVADVLVSAFDSAGQRCSALR
VLCVQEDCADRVLTMLRGAVEELRVGNPAELHTDVGPVISAEAQSGIQTYIDASRAQNRA
VWSLPLPDTTSNGTFIAPTIIEIDSLADLKGEVFGPVLHVLRFEASGFEALINAINQSGY
GLTFGLHTRIESRMAHVTSRIEAGNLYVNRNMVGAVVGSQPFGGEKLSGTGPKAGGPLIL
RRLMSTAPAHTDWENQELPEPARLFLSWLMRTSFPLYQTIVDAMQHGMCGTTRELPGPVG
ETNLYQLLPRGAVLCVASDRETMLRAVGLALSGGNTAFVQGPNVASDWVSDLPDALALHI
RRTQGGRVAGCRTILASPEEKQMAEQTRAALSRSGMIVQLYMLDAKSPIRPEWVLQEKVV
STNTTAAGGNASLMTIG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]