dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Gorai.007G139300.4|PACid:26783277 (Gossypium raimondii v221)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 1848
Sequence
MATVKRADSKGMYSWWWNSHISRKNSKWLQENLTDMDTKVKQMIKLIEEDADSFARRAEM
YYKKRPELMKLVEEFYRAYRALAERYDHATGVLRQAHQTMAEVFPNQVPMVFADDSPGGF
APEVDPCTPEMTPLVRAYLEPDELQKDSVGISSHAIKRNVAFSEESESPMSRKGLKHFNY
VLGSEESTNHVKFAEGRARKILNFHDVEKKERSLQDDDGSDLRVRVPSESERVSKAEMEI
LTLKNALARLEAEKEAGLLEYQQSLDRLTNLEREVSRAQEDSKGLNERASQAEAEVQTLK
DALTKLQAEREANHVQYQQCLEKINNLENSISHAQKDAGELNERASKAETEAQALKQDLS
RVEAEKEDALARYKQCSETISDLEEKLSNAQESARTMTERAEKAESEVETLKQVVVELTK
DKEAAALQYQQCLETISILENRLRCAQEEAQRLKSEIDDGAAKLKGAEERCSLLERTNQS
LHTEVESLVQKMGDQSQELTEKHKELGRLWASIQEERLRFMEAETAFQTLQHLHSQSQEE
LRSLAMELQNRAQILQDIETRNQNLEDELQRVKEENTGLNKLNLSSAMSIQNLQDEILSL
RETIAKLEAEVELRVDQRNALQQEIYCLKEELNDLNKRHQDMTGQLQSVCLNPENFASTV
KELWDENTELKDVCERERDEKLALLEKLKIMEKLIEKNALLENSLSDLNVELEGVRGRVK
TIEESCQSLLREKSTLAAEKDTLISQLQTATENMEKLSEKNNFLENTLFDANAELEVLRQ
KIRSLENSFLLLGDEKSGLITQREGLISQLDVNQKRLEDLEKRYMGLEEKHVGLEKERES
TLREVEELQKSLEAEMQQHASFVQLSRTRETAMESQIHVLQGESLLRKKEYEEELDKAMN
AHVDIFILQKCAQDLEDKNMSLLLECRKLLEASKLSEKLISELELGNCEKQVEIKALFDQ
ITILRMGLYQMSRTLEIDDIHGCDDKIKQDQLVLDCVFGRLQEMQNSLLKSLDENQRFII
ENSVLIALLGQLKLEAETLAAEKNSVRQELKVQSVQFSELLIRAEKLADMNEVLRSKVVE
VNQREDALQTELISVRGQLLALQRQYQTSLEDNCKVLDEKRSLMKEVLDLGKQKHNLEDE
NHAVICEAISQSNISLILKDIIANNFEEIKYLNDNLGKLKCLNNDLEGKLKMMERKFEDL
QMENSNLKDSMKKLENELVSVRSVGDQLNDEVARGKDLLCQREIALLEVEKMLSASQKET
AQLHKVLEDLQTKFEEVKLIGEDQKRQILKLSGDYDHQIKETESISQANQKLEVELLKLN
EELEESKHREESLSFELQKERIKVEIWETQAAAWFDELQTSAIREVIFEEKAHELGKECK
FLESTRNSTAMEVEELERSVRSLECENGGLKAQLAAYVPAIVSLLDSVTSLESRTLLHPE
LPTDYNEEDPNLGTEFHAENCQPTSEGQIGLVPNGFSDLQGIHMRIKAIEKAVLEMEKLA
MLENLNLNSKLETATRQIEELRYGSSSSGESVRAKRHVSARQEEEELGNGLSNNVNMQRP
TPEISEENEMMTKDIILDQVSECSSYGLSRRGTAAEVDTETLELWETADHDANADLKVSK
AQKMATAPTDYQQIGTVKAGKGRTPSTESLVKELGVDKESSKRFAEPNNNGSKRKILERL
DSDVQKLANLQITVQDLKKKVEIIETGKKGKGIEYGTVKEQLEEAEEAITKLFDVNRKLM
THVEDGSWSFDGKSALEPDENGSVRRRRVSEQARRGSEKIGRLQLEVQKIQFFLLNLDDK
KESKAQTRITERRRRVLLRDYLYGGVKSSQKKKKSPFCACVHPPTNGD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]