dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|78779424|ref|YP_397536.1| (Prochlorococcus marinus str. MIT 9312)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ferric uptake regulator family protein [Prochlorococcus marinus str. MIT 9312]
Sequence length 144
Sequence
MIKNTGQKKISETMVTNSDITKRQEQLLEELNKCEDELTGQKLHRQLIERGKVMGLTTVY
RNLQVLIKHGLIRSRHLPTGEVLYTPVDRDIHHLTCVQCGETSKMEGCPVKDIHTPKTNP
KKFQLLFHTLEYFGLCQNCYQAQN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]