dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|390936998|ref|YP_006394557.1| (Bifidobacterium bifidum BGN4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment acetylornithine amino transferase [Bifidobacterium bifidum BGN4]
Sequence length 429
Sequence
MPTKETLGPTDSQWLGQYSQVHMNVFGTPLRVMDHGEGVRVWDVDGNEYLDFLAGIAVNS
LGYAHPAWVKAVSEQAAKCAHVSNYFATEPQIRLASRLIELAGAPEGSHVYFGNSGAEGN
EAALKLAKLYGRTLPGASPSIGGKPARILALTHGFHGRTMGALSATWKPVIRKPFEPLVP
NIEFVRAGDPIAMYEAFSATGLGQYGKGPVAAVILELIQGEAGVRPLDVAYVKKVREMCD
INHALLIIDEVQTGIGRTGSWFAFQREDLTGGITPDIVTFAKGVAGGFPMGGMISFGGKL
SALFTPGSHGSTFAGNPLGAAAALATLDTIENEHLVENAEERGEQLRQGVMASGNPLFTS
VRGRGLLNAILLSHRCSHAAMNWALEHGLIVNAVAPDALRLAPPLIVSEQEIDEAVSILA
KIPADLPND

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]