dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|474986435|ref|YP_007696901.1| (Streptomyces hygroscopicus subsp. jinggangensis TL01)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence length 933
Sequence
MSFDDLPLMGAVGPLVGRDRDLELVSGFLAHTGFSGALLLRGDPGVGKTVVLDALARSAA
DTGTCVLRIAGVQFEADVSYAALNQAFLPLRDVLDTLDGTHREALRVALGFGAGQPPERL
VVLNAALALLQAAATRSPVLIIVDDLPWVDRASAAVFGFVARRLSGTRIRFLAAMRPGAD
SFFESGGLPTYELPPLDTESATRLIDARFPHLARQVRRRVLHTAQGNPLALLELPRALRA
SQRAALETLPAVLPLGQRLQSLFMSRVRGLPTATRKLLLLAALEGSGEIGVLCGAAREWD
GSTGLEDLAPAEHDQLVRVDEDSRRLVFRHPLIRSAVVEAATSSSRRAAHRALAQVLSGR
PESRAWHLGEATIEPDEQVAARLEEAAHRILGRGDAVAAIAALTRAADLSPLGADRARRL
AEAAYIGAEATGALRSASELLENARRADPDHGRSLHSAAATVQLLLNGDGDVTTAHRLLV
GAIEEGTHGYDAGNAALIDALHLLSLLCIYGARAELWAPFHAALARLRPAPPALLSVLGQ
LYSDPARTGPATLRRFDRIIDGITDETDPARIVRVGTAAVYTDRLSALRAPSWRVVRQGR
NGGPVRRHLGVLLHLGLDGYHTGSWDEAIELADEGLALCTDSGYSFFSWYFHFSKGLVSA
SRGDIDTALMLADRMTDWASPRGLRSIVQYAHHVRVLTHGATGDFEAVFRHADAISPAGS
LEPYAQPSVWVFFDLVESALRTGRQAEARAHVRAVRASTVEALSPRLALLAGGAAGLVAE
DDEVAERFFNEALSAPGADEWPFDRARVQLARGERLRRAGAASEAEGPLRSAHGTFRRLG
ARPWTARAVQELRAVGSKVADTNDLRGTELTPREREIAELAASGLTNKQIAERFFISPRT
VGAHLYQIYPKLGVASRAALRDALTADPARHAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]