dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|18314012|ref|NP_560679.1| (Pyrobaculum aerophilum str. IM2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment branched-chain amino acid binding protein [Pyrobaculum aerophilum str. IM2]
Sequence length 449
Sequence
MASKTLYIGIIVAVVIIAIAAALLSMGGGQQTPTQSPTTPRPTQSPTSPTATPTQTPTQT
SPTPTKKTVYIGAALPLTGGSQSYGIGVKNAVELAVEDANKMCPNIKFELLVEDTGTNPQ
QALQKVQTLYAKGARLIVGPMTSGEVSAVKSFADQNKIIIFSPSSTSPLLGIPGDWVYRI
VPTDFAQAAAIADLLKTLGVKRAVIIYRNDAWGVGLRNAITNESNKLGINIVASQGYDPD
PKAFPTAVPEAIRKLSGALGQPGSDAAIIFVTFEDDGIAAIQAAASDPVLSKVRWIGTDG
IAYSDALIKQVGKEMAAAKMLGTIAAPDPNDPKYQEFKQRYKAKYGKDPVAYDPYGYDAA
MMLMQIACQLGTDDSDKVKATLEQWGRQGTYQGVTGKVYLDEAGDRAYPNYVIWGVALEG
GQPKYVDAAYYYGTDRKITIFDQGKQFFQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]