dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|14590174|ref|NP_142239.1| (Pyrococcus horikoshii OT3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glucosamine--fructose-6-phosphate aminotransferase [Pyrococcus horikoshii OT3]
Sequence length 601
Sequence
MENVCGIIGYIGPRKASDVIVEGLKRLEYRGYDSAGIATCYEGKIFIKKGAGKIDELVKK
LNFLELPGNIGIGHTRWATHGIPNDTNAHPHTDCTGKIVVVHNGIIENFQELKRELLKRG
HVFRSDTDTEVIAHLIEENLRITGNFEDAFRMSLLRLRGSYALVVLFADDPERLYIARKD
SPLIIGIGKGEMFMASDIPAFLAYTRRAVFLDDGEYGIVSKDWFTIKDIITGAVKTKEIH
EIQWTLEMAEKGGYEHFMLKEIFEQPKAIKDAIYGNVKEAPKVAELLMKYDRIIITGMGT
SYHAALVGKYLIQRFGKVPVIVEEASELRYEYEDILDNRSLLIAITQSGETADTVAAMKL
AKSKGVEVVGIVNVVGSLATRIADETLYTHAGPEIGVAATKTYTTQLVVLTLLAKELGKL
VGIDVSQIEGTIPRLPELVDSSLKINDKIREIAVKLNDKRDFFYIGRGINYPTALEGALK
IKEIAYVHAEGLSAGELKHGPLALIEDGIPVVGIAPTGKTFEKMLSNIEEAKARGGFIIS
LGDDVRLHQVSDIFIRLPKVPEELAPITYIVPLQLLAYHLAVLKGHNPDRPRNLAKSVTV
E

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]