dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|10957446|ref|NP_051566.1|NC_000958 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sigma-B regulator RsbS [Deinococcus radiodurans R1 plasmid MP1]
Sequence length 141
Sequence
MDRLPILKLGDCLLVTIQVELHDRLALTLQDDLTTMIANTGARGVLIDISALDIVDSFIA
RVLGNIAAMSRVLGAETMVVGMQPAVAITLVELGVTWQHMHTALSVERGLERLKVLIAER
HTLRGHSPRGKRGGGVDGSRH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]