dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|186687245|ref|YP_001870388.1|NC_010632 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CheB methylesterase [Nostoc punctiforme PCC 73102 plasmid pNPUN02]
Sequence length 336
Sequence
MLEHNIIVIGTSAGGVEALTYLVKHLPPDLKAAVIIVLHVSNHGTSVLPKILSRAGNLPA
SHAQDGEAIIHGRIYIAPPDYHLLVESVYLRLTRGPKENRHRPAIDTLFRSAARSYGQRA
IAVLLTGMLDDGTAGLVAIKMRGGVAIVQNPDDALHPDMPRNAIENVLDIDYIQPLSDIP
STLVALVNTPMKVEPENPIPDKMEFESSIVQLDLEAVKNEADRPGKPSIFGCPDCGGILW
ELEEGNLLRFRCRTGHAFSAETLLATQSDKVEDALWIAFRALEEKASLSHRMALRMEEHN
QALAAKRFKEQAESAWQHSAIIREILLKADTSTGVD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]