dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|300694698|ref|YP_003750671.1|NC_014310 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Chemotaxis response regulator protein-glutamate methylesterase [Ralstonia solanacearum PSI07 plasmid mpPSI07]
Sequence length 333
Sequence
MNIGIVNDLPLAVAALRRAIARRPEHRVLWVATDGAQAVDFCAAEPPDVVLMDLVMPRSD
GVEATRRIMASSHPCAILVVTSSVGANAWRVYEAMGAGALDAVDTPTLADGDGGAVPLLA
KIDQIGRLAERPVAPVWHASAPRRDDAVPLVAIGASAGGPAALATVLGKLPADFGAGIAI
VQHVDQAFAAGMAAWLDGQTALKVRVGVAGDQPRPGEVLMAATNDHMCVREDGTFGYTCE
PLSTPYRPSVDVFFHSVVACWQGDAIGVLLTGMGRDGAIGLKAMRARGYPTIAQDEATSA
VYGMPKAAAELGAASAILPLDRIADELAARVGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]