dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|325113238|ref|YP_004277184.1|NC_015178 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aldehyde dehydrogenase [Acidiphilium multivorum AIU301 plasmid pACMV1]
Sequence length 490
Sequence
MMRRFRQYIDGEFVDAARSFESIDPATGDAWSLMPEADAADVDRAVTAAHRALHDLSWSG
LTPTARGRLLYRLGDLLEEQAQALAELETRDTGKVIRETSAQVAYIAEYYRYFGGLADKI
EGAHLAVDKPDMEVYLRREPIGVVAAVVPWNSQLFLAAVKIGPALAAGCTVVVKASEDGP
APLLEFAQLVDQAGFPPGVVNIITGFGDPCGQRLTSHPLVSRIAFTGGPETARHVVRNSA
ENLSHVTLELGGKSPVLVFDDADLDNACNAIIAGIFAASGQSCVAGSRLLVQNSIHDTLV
SMLSERVGKIKIGDPSDPATEMGPLATARQHRKAVEVIQSSVKAGAVLTAGGKVPPGHER
GFYLEPTILQCPNNDIPCSREELFAPVLSVMRFDTEADGIAFANDTCFALAAGIFTNDLR
RAHRLIRSVKAGVVWVNTYRAISPVVPFGGFGWSGLGREGGRESVMEYTRPKAVWINSST
CPFPDPFIMR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]