dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386038122|ref|YP_005960998.1|NC_017543 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tenascin-R TN-R; Restrictin; Flags: Precursor [Paenibacillus polymyxa M1 plasmid pPPM1a]
Sequence length 1039
Sequence
MKIKKHLSTLLVTSLLVGGFIGFGIKTEASGSFNTKYQLLSPGEVNLYWDQQPISGNYWI
YRDNVLLGKVPAGYVPSFWDEEATPGTHVYRIDAIDTVTGTKLIDSESITVNTKEADEAL
PTSFKIGNRTASVNASFVKIGGVVFRPLADNYLISSKAVVESNWLPSNWKKNDFSNSGLD
KKIENTWLPTLNDTEYESLKVTSYSAPGWEGNLITNPIVDERAVPPTMKELLKYSSLYDI
PTENLNAGQFVRDKMFNNSITYVYGSSDNIHKIRVHRSTSSSFPTALVITLKSSTKLSGE
GTSRNPYTISSVGPENPSLQTPNGLKLVSSKAGHTSFSWDIVEKATSYIVKRDGIDIGTV
STTVFEDSSTVAGSSYNYTITAKGTDGSSSQESASLKIDVQAPPVLKAPANFKELGKTHN
SVLLGWDAVVGATSYQLTSDGSVAYEGSNTQINISSLSPGDYTFKVKAISDGISGPESIV
KVSIKENTLDYPIGLSVTNATYNTISLKWNSVNGAESYIIQRDGVEVGRTTNTNFSDENV
QPGAQYDYGVMAINGSIKSENSKLTVTVPTKPIEGLAPGIPSGFKVTRAYADKVKLQWAT
VSDATYYDLIRDSGTLVYRGPLTAITDETTGPEESYTYHIIAANQFGKSLPSSTIAVTTP
AEAPAIVVSPSPVVEGTITFKFNMVEGAQSYKVERNPEVTYDNNGNGTFHLTYFNTVTGE
TRDYGNVTPIDNKLPFYETGVDPGKDYHYEITAIRMSSLGIPEVIGKSEVSINTPSDGSG
VTIPAEEDSTQDKPGDKSKSKKNKDSHEDVISNNSTGKAITGSSGSTLSSVKNSISPDSS
KRFAEITNAPQSTVSESTYMFTDLTGNFAEQAVYSLAKHGTIIGYEDGTFGPDKKISRAE
FAIMLTRAMKYSSDEGYVNNFKDFDMNTWYSKELAVALNNKVTKGFDKDTYKPNSLIPRE
QAAVMVANIMRTKMADNGNEILYTDKNNIIDWARSDVLFTSSLDIFNGYSDGTFLPKRQI
TRAEAAVVIYRMLSKINNK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]