dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|392384140|ref|YP_005033336.1|NC_016618 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 5,10-methylenetetrahydrofolate reductase [Azospirillum brasilense Sp245 plasmid AZOBR_p2]
Sequence length 294
Sequence
MTAPLSAPPSISFEFFPPKTESMEQGLWQSIRRLAPLAPSFVSVTHGAGGSTRERTHATV
CRIQDETGLPAAAHVTCVGATRDEIDTIAHSYWNAGIRHLVALRGDPSDMPGGSGRCEPS
PGGYAYAADLVAGMRRIADFEISVAAYPESHPEAPSVQFDLDNLKRKVDAGATRAITQFV
FDNDVYFRFLDRCAAAGIHVPVIPGILPITNVARAVEFAAKCGASMPARLVETFEGLDDD
PETRRLVAATVAAEQCQALQAQGVRDFHFHTLNRSDITLATCHMLGIRAAVPAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]