dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|557225954|ref|YP_008766168.1|NC_022739 (NCBI plasmid sequences)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment enoyl-CoA hydratase [Pseudomonas sp. VLB120 plasmid pSTY]
Sequence length 263
Sequence
MTFEHILFSVEAGVATLSLNRPEQLNSFNAAMHGEVREALKRVRQNPEVRVLLLTGEGRG
FCAGQDLADRNVAPGAEAPDLGESIEKFYNPLIRTLRDLPLPVICAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLIPDSGGTWSLPRLVGLARAKALALLGERLTAEQAEQWG
LIYRVVDDAELRDEALKLARHLATQPTYGLALIKRSLNASLNNDFDAQLDLERDLQCLAG
RSEDYREGVAAFMAKRTPVFKGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]