dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|15602301|ref|NP_245373.1| (Pasteurella multocida subsp. multocida str. Pm70)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PM0436 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence length 403
Sequence
MAIKQSTRLAFFKKSVQKQPHFLHCKLSFACHQTVIFVHYNHFRYHMVVIEKTLKGVTSM
TKRAMLLAILFSTFALTTQAQTITGAGASFPYPIYAKWASMYEKQTGNKVNYQSIGSGGG
QQQIIAKTIDFGASDDPMKAELLAQHQLLQFPAIIGGTVPVVNLPEITAGQLKLSGEVLA
DIFLGKIKKWNDPAIAKLNQGANLPDKAIIVVHRSDGSGTTFGWTNYLSKVSTEWKETVG
QGKSVKWPTGQGGKGNEGVAAYVSKIKYSIGYVEYAYAKQNQLAWASLQNKAGQFVQPSA
ESFMAAAANAQWESAVGMGVILTNEEGDTSWPVTAASFILLHKHAEKPEITKAVFDFFDW
AFKQGKVAATELDYVPLPEEVIQKIQAQWKTEVKSSDGKTLWQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]