dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|77459314|ref|YP_348821.1| (Pseudomonas fluorescens Pf0-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment extracellular solute-binding protein [Pseudomonas fluorescens Pf0-1]
Sequence length 282
Sequence
MHRRPSLFKACVFVLAASSAVMGIAQAADSKLDSVLARGKLIVGTGSTNAPWHFQGADGK
LQGFDIDIARMVAKGLFNDPSKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQQVA
FTLPYYREGVGLLLPNNSKYKEIEDLQAGGDGVTVAVLQNVYAEELVHQALPKAKVDQYD
SVDLMYQAVNSGRADAAATDQSSVKYLMVQNPGRYRSPTYAWSPQTYACAVKRGDQDWLN
FVNTALHEAMTGVEFPTYAASFKQWFGVDLPSPAIGFPVEFK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]