dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|77460224|ref|YP_349731.1| (Pseudomonas fluorescens Pf0-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcriptional regulator CysB [Pseudomonas fluorescens Pf0-1]
Sequence length 324
Sequence
MKLQQLRYIWEVAHHDLNVSATAQSLYTSQPGISKQIRLLEDELGVEVFARSGKHLTRVT
PAGERIITTAGEILRKVESIKQIAQEFSNEKKGTLSIATTHTQARYALPPVISNFIKQYP
DVALHMHQGSPMQIAEMAADGTVDFAIATEALELFGDLVMMPCYRWNRCVVVPQGHPLTK
LPKLTLEALAEYPIVTYVFGFTGRSKLDEAFSHRGLTPKVVFTAADADVIKTYVRLGLGV
GIVAKMAVDTKLDNDLVVLDASELFESSVTKIGFRRGTFLRGFMCDFIEKFAPHLTREVM
AKAIQCHNKQELEELFEGVELPVH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]