dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|77460858|ref|YP_350365.1| (Pseudomonas fluorescens Pf0-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment LysR family transcriptional regulator [Pseudomonas fluorescens Pf0-1]
Sequence length 301
Sequence
MDLFQSMSVYVKVVESGSMTAAALQCEMSTTMVGNHLRALEQRLGVQLLQRTTRRQRLTE
FGSVYYQRCLEVLGLVADSERLAEQTLDEPRGILRVTAPLTFGVERLAPALSEFSLQCPQ
VKLDVILTNRRPDLLESGLDVAFRLGHFDQSNLIARPLIDYTLTVCASPEYVARRGMPLT
PEELRQHDCLSFAYPAGDDWQSVEKQWRLSGPDGEIMVDVKGPMLINSSAGLHQAARTGM
GIVMLPDALVEQDLRDGRLVVVMPDYQPPNRPMHLLYAPDRYRLPKLRRFVEFALQMWGR
P

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]