dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|379734758|ref|YP_005328264.1| (Blastococcus saxobsidens DD2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment carboxylase subunit of acetyl-CoA carboxylase [Blastococcus saxobsidens DD2]
Sequence length 493
Sequence
MADVELVDVSIRDGNQSLWGATGLRTAHIAQVAPLMERVGFRALDYSSSTAMGVAVRTHR
EDPWERLRLTRAAMPTTKLQFIGTGFRFISWQNSHPETMQLVYDRLVANGIDRVVVLDPM
HDMDAARETARRLKQAGVDEVIGALTFTISVVHDDAFYADLAGQFAADPNFDRVYVKDPA
GILTAERARTLLPAIVGRLGGMPLELHSHATIGLSPLTYSIAPELGVAVVQVGSGPLGNG
SSLPEARRTVANLREMGHRVDVDDRALGLVCDFLDGLAVAEELPAGQPQDFDAAFLHHQI
AGGVMTTTRRQLQEIGMEHRFEALVEEVGVVRAEMGHPIMVTPFPQMVVSQALFNVIGER
YATVPDQVIRYVLGSFGRPTAPIDPTVKDRILDRPRARELASEPPPPTPAELRKQFHPGI
SDEELLLRAHMPEDQVDAMLAAGPAPRHFNPSLAPVLTLLRELGSRTSVHDLAVTTPGLR
MSVRRASEGTSVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]