dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|26991942|ref|NP_747367.1| (Pseudomonas putida KT2440)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment acetyl-CoA hydrolase/transferase [Pseudomonas putida KT2440]
Sequence length 597
Sequence
MGLPLGLGKPNAFVNALYARVRELPERRLTIYTALSLGRPPLGDGLQRRFLEPFVERVFA
DYEELSYLADLRNDTLPPNIRVEQFFMQPGSLLHSESAQQDYVSSNYSHAARDINAKGLN
LIAQLVAATPEKPVHLSLACNPDITLDLLPMIAKRRAAGETILMLGQVHAELPYMPGDAE
LPIDAFDLLLDEVEQRRLFSTPNMPVGIQDHCIGLHASSLVRDGGTLQIGIGAMGDAVAA
ALLARQGDNAGYRAVLKALDVGPWQALIEREGGLDTLTHGLYGCSEMFVNGLLVLAEAGL
LRRPADEQGAILHGGFFLGPQAFYQRLREMPLEQRAQFVMTRISFINELYGQEALKRRQR
RDARFINTAFGMTLLGAGVADQLEDGRVLSGVGGQYNFVAQGHALEGGRSILLLRSWREA
GGEVTSNLFWTYGHCTIPRHLRDIVVTEYGIADLRGQTDSEVIARLLAVSDSRFQPGLIK
QAKDAGKLADDFQLEARFTDNTPQRLEAIRAQHARLFPEYPMGTDFTAEERDLLRALNWL
KSKFKLSEVLELGKAALDAPGPEGYESHLGRMQLGQPQGLKEELYQRLLLAGLAATR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]