dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

POPTR_0004s03530.1|PACid:18225369 (Populus trichocarpa v156)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 918
Sequence
MSSSPPHLPTSTTATTANNNNTSCSSSSTALSRKCFNSDCTDFKSRKGWRLRSGDFAELC
DRCASAYEEGSFCETFHLRASGWRCCESCGKGVHCGCIVSIQTFTLLDAGGIACMACERK
SFVLESNPQILLTATSADVTSNPAWSPLFYHAPFPERLKDLSVKSWSQLAGSGPVPWRQA
PSLFNPSAAQSELQTRMPYEVDRLNTGERFSAPSLEKRKVEDFSEKFINGNLRIRLQDIV
ENGNAGIIGEEQPQPSSSLMEDASGQQFGITIPYKSISESNSQIEGSVNALQPAPPPPFT
KHFHGSLHNGVDSSVDGHIRNGKPRTDARGRSQLLPRYWPRFTDGELQQISGNSNSVIKP
LFEKMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLRVQDSKGKEWIFQFRFWPNNN
SRMYVLEGVTPCIQNMQLQAGDIVTFSRLEPEGKLVMGFRKATSAPPSDQDNETSQTGNG
VSTKGDAELDPSPWSKVDKSGYIAKEVLEGKSSIRKRKSSTLGSKSKRLRIENEDMIELK
LTWEEAQGLLRPPPDHVPSIVAIEGFEFEEYEDAPVLGKPTIFATDNVGQKIQWVQCEDC
LKWRKLPANALLPSKWACSSNTWDPERSSCSVAQELTAEQLEDLLPSCNLVVTSKRSKDA
KKDIDRVEALEGLDTLANLAILGEGEAFPASSQATTKHPRHRPGCSCIVCIQPPSGKGPK
HKQTCTCNVCQTVKRRFKTLMMKREKKQSEKEAETKQSEKEAETTRKRQQEPSAEKLLDD
EPSPSSNTGSESGSPNKKKTVSEGSDDDPSRMKSSTSPFKGQIDLNIQPEREDELSPGSD
SGGMMRMLQDATETYLRMQRFLSSDGDNNPSGNHMLSSGGTREKVSDVIMLGSSHQDADK
DHPSAFSMNASASTPATG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]