dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|18977987|ref|NP_579344.1| (Pyrococcus furiosus DSM 3638)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PF1615 [Pyrococcus furiosus DSM 3638]
Sequence length 970
Sequence
MIILRVVNVAVPLKRIDKIRWEIPKFDKRMKVPGRVYADDVLIEKMRQDRTLEQAANVAM
LPGIYKYSIVMPDGHQGYGFPIGGVAAFDIKEGVISPGGIGYDINCLAPGTKVLTEHGYW
LKIEEMPEKFKLQRLRLYNIEEGHNDFSRVAFVAERNIEKDETAIRIVTETGTLIEGSED
HPVLTPQGYVYLKNIKEGDYVIVYPFEGVPYEEKKGIIIDESAFEGEDPQVIKFLKERNL
LPLRWEDPKIGTLARILGFALGDGHLGEMGGRLVLAFYGREETLRELKKDLESLGIKANL
YVREKNYRIKTESGEYSGKTVLAELRVSSRSFALLLEKLGMPRGEKTKKAYRIPVWIMEA
PLWVKRNFLAGFFGADGSIVEFKGTTPLPIHLTQAKDVALEENLKEFLYDISRILEEFGV
KTTIYKVNSKKSVTYRLSIVGEENIRNFLGKINYEYDPKKKAKGLIAYAYLKFKESVKKE
RRKAMEISKKIYEETGNIDRAYKAVKDIVNRRFVERTIYEGERNPRVPKNFLTFEEFAKE
RGYEGGFVAEKVVKVERIKPEYDRFYDIGVYHEAHNFIANGIVVHNCGVRLIRTNLTEKD
VRPKIKQLVDTLFKNVPSGVGSQGKVRLHWTQIDDVLVDGAKWAVDQGYGWERDLERLEE
GGRMEGADPDAVSQRAKQRGAPQLGSLGSGNHFLEVQVVDKIFDEEIAKAYGLFEGQVVV
MVHTGSRGLGHQVASDYLRIMERAIRKYGIPWPDRELVSVPFQSEEGQRYFSAMKAAANF
AWANRQMITHWVRESFQEVFRQDPEGDLGMEIVYDVAHNIGKVEEHEVDGKKVKVIVHRK
GATRAFPPGHEAIPKIYRDVGQPVLIPGSMGTASYVLAGTEGAMAETFGSTCHGAGRVLS
RAAATRQYRGDRIRDELLRRGIYVRAASMRVVAEEAPGAYKNVDNVVKVVSEAGIAKLVA
RMRPIGVAKG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]