dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Conpu1|140441|estExt_fgenesh1_pm.C_190089 (Coniophora puteana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 819
Sequence
MDGPSTATVSAQSHTQTQQDKVAARPYKCPYPLCGRAFSRLEHQTRHIRTHTGEKPFACT
FPSCEKRFSRSDELTRHSRIHNNEHQSQHATGKRAKPKSEHPLHDDHLDQGNSVSLHSYS
RSTHESAADSSSVRIKKKARSRANSDDEGESYARPTALGSYESSYHPRRAQPHHLPQSNP
SAFSTLSSVAMDELYALERAEALRRAEYEARHAEVLRRAESDLRPPTDSHSSAYHMHGAR
MVKSATTSPVSTPFHFGQPLSGAGADAGYFGIGVSDERSTKNRRRLSGPAWQITPISSPN
STPAEAQTGRSGAAGQQYPASGTVSASAYSHASQHPASVHRQFPRQEDTPSPLSSDSDSL
PLPGSHANGASRTRYGGSHHDMSPPLVQAKPQPRDAAAYAYTPSASPFLGPLRTLNLHSG
YPSRAPSPILLPPSAHDEDDDDSMQTSPVDDDATRPHGYGYGYGYSQYATSGTRSPISGS
GAYSRSRTSSARKRPSADGFALPASAAHLPHVHSYPGQLSSAVGAGSSSGPASGAGNSSL
HALPTPQLSSGPSSSGSSPASFTHPLRGGHTYEPGAGSTTASPVGSRPASPPHHHERERE
QATGNGNGNGAPHHHHLAHSVRMAFGMTPIHSASSASTSHAHSHSHAHPHSPYPNQYTHT
ARTPSWPATAHPAQTQFSFKSPSRVGSGPGASAGAGAGVTAYGHRDGWGVASVPASRSGS
PPITLAPLKIKSESPGATMGGVGSNMGSGATSPTTATASSSTAMVVEKTKVEVEGEKGEE
VVETGQEKMAGGLKTEKTAVEKVELPTFKEFEASTLASR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]