dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Conpu1|143709|estExt_fgenesh1_pg.C_5_t10459 (Coniophora puteana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 1397
Sequence
MENGQPNHGAPTSNSAVSVNTNVPPFLDERRYNYAIAHIQRARQQLDRYESTINNSHQRY
LEETIDQGRRAQQMLQIMYATQAHGQAPGQAQVQAQIQAQAQAQVRAQAQAQSGSNAQSI
QAPPRVASVHPGWFPPPNSAAVAVDPRGNQVPLTARSDSPRMMNPFHASAPMQDGRAFSQ
VGAQQRVPQFAHHQGLTQQHVNPTSHPPHPPGFPNPDQIPQGHSMARIPMNQASAMANYW
ETLGRITQAQQSQQQQKQQFNPQVQPHNNQTPYHLATTTSLDNALGNTFGDRPIGAAQAN
GAAPANRSSSTHVRQTNDTDGSGQNVRMQETQLEYSRSESRHVQSSSPPIVSLPTAELQR
NTAGLSSSIPGAAQSKDALLPKPSESSFAIPVQKSIAPSNVSGTEFPHRETAVRQNPAPL
TLQPSQPGGQSQDNRAPPEPTTTSLNTFANKPVRFEAPSESPIATQTGQHPRLPHHAIRS
HALRPLSEMNSSQHTTGSIHVPGPSQRIPNLALVHNQSPINAARSLDPSLYRPFSFSNHP
LPPNAGPAPPTVDSEAPRTSPRQRSPEAGPSSPAPVIAALSPPETPLKIRASPNPRTPSQ
ADMRRLAKDIQRSLRRPGMQAPGQRLPSVNALGPKPIIKSSQQSQEPLLDFKPRDASSVD
SQTTEVDMAIHNSAPVALIAAQDESLGAKELQPQLHGADAAVETSRGFMVGQIRNSLPDS
SYAITQPTPNQVPLSPDGGQAKGNPVSNDDGEHETAFVGPLPQPPEQIVLEGYQEYVNPS
HLPFPEPAPSQPPTVHPTVDVDIPSQRYGHLLIDDDTIANSSNYPSTLISPSFGEAPFDI
AMEYTTSHNDQELELGPSTRIEEVIASPVQSTSGRVHEVSVVHEAISPSQFGPGHSNQSP
VQERVRPPIASLAGPSQATHVHEVNSTELLSFGHTQETPIREKSGTQAAIKTPLFLHSPT
PSPEPPCLPAELTSSALDVIDLTADSLADGDPVIPSQADPIAATATKEYTVISSKSSSAA
AESTGGLVRTSTKRKRTSDTRKSFYILVPTPNWLRRKRRKAGGGRPARLGGEHQKSHNFT
PEEQQILEASGQMLRERPCLWKDCQAVMNSGDNLFLHIIRHHVPTEGVVQCRWQDCNQVL
ASTGTVVEHHLVSHVLRVMPCPDIHCFEDFSDPIDLLQHNKRHQNDDRYLFKVTKPYHPI
VAAEPEGIPTIMPSYQSVPRRISQHPMSRQDHDRIGQMVLRNIFAPVGLKLRKQNAPMRT
RGSRLLYEQEGSSHSRPDEYDFLASLSSGPAKLMLADIDNHEVTKMCEADLVLWRGDDLC
WNGQEEFGVAMENEDGTNLEGPDGLIKGNTTGKDADPDVIEEERDQTFARSRGSEMSDGT
DGRNVGEEEDVALMLEP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]