dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|429191362|ref|YP_007177040.1| (Natronobacterium gregoryi SP2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transposase [Natronobacterium gregoryi SP2]
Sequence length 367
Sequence
MGGDRRGELVRHLSEEELDRLLDEADDPKVVKRLTFVKRLYKGATYEEAADDVGKSASTG
SRWARRWNDGGLGQLTPNFGGGRPPKLGDEEQECLLELLREGQPWKAQEVHQLLDEEFDV
EYHPDYLGRFLRNLGLSYAKPRPKRPSRPENADEILEERVADAFDEETETAHNKRPEDED
EGWVLDDDICTDGGTIVGFCDASHPQPYDNSHRLWYVDDPTLERPLVKLDEPAVGCYTLN
GESVLTFPEDQSKENICALLEEVREQNPGTRILLVLDNFSSHICEHTRKRAHQLGIDLVF
LPVGSPHLNPIEQVWKVLKRNASPIVVASESAFRTLARRLFNTLTDRLGFAKSWIDQFLS
PYLQKLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]